PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g030460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 208aa    MW: 23847.3 Da    PI: 8.9314
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g030460.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19364157
                      TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      r +R+++t+eql  Lee+++k  r+p+a++++ ++ +l    +++ ++V++WFqN++a++++
  Sopen11g030460.1  3 RPTRWSPTPEQLMFLEEMYRKgLRNPNATQIQSITCHLssfgKIEGKNVFYWFQNHKARDRQ 64
                      569*****************99*************************************996 PP

2Wus_type_Homeobox111.54.4e-36565464
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       tRW+PtpeQ++ Lee+y++Glr+Pn+ +iq it +L+++Gkie+kNVfyWFQN+kaR+rqk
   Sopen11g030460.1  5 TRWSPTPEQLMFLEEMYRKGLRNPNATQIQSITCHLSSFGKIEGKNVFYWFQNHKARDRQK 65
                       8***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.333165IPR001356Homeobox domain
SMARTSM003894.5E-5269IPR001356Homeobox domain
SuperFamilySSF466892.44E-11369IPR009057Homeodomain-like
PfamPF000463.3E-17364IPR001356Homeobox domain
CDDcd000861.58E-4365No hitNo description
Gene3DG3DSA:1.10.10.601.3E-6664IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRPTRWSPT PEQLMFLEEM YRKGLRNPNA TQIQSITCHL SSFGKIEGKN VFYWFQNHKA  60
RDRQKLKKKL LAQMNQQQIL AQYPIDAHST TTTTNSNNNT LFHCPTTDQY QICPLTSTTA  120
LLQEGGIKEA SSQVMTYLYP MDLSKPADQN MENCMIRPYG KDWIVMMNIN PNNSPYCLNR  180
PLKTLPLFPI TTTDDLKDQT TSSTSLSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057299.11e-156PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLK4DAY61e-142K4DAY6_SOLLC; Uncharacterized protein
STRINGSolyc11g072790.1.11e-141(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-39WOX family protein